Lineage for d1u6ah2 (1u6a H:114-213)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655115Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 655265Domain d1u6ah2: 1u6a H:114-213 [119565]
    Other proteins in same PDB: d1u6ah1, d1u6al1, d1u6al2
    automatically matched to d1aqkh2

Details for d1u6ah2

PDB Entry: 1u6a (more details), 2.81 Å

PDB Description: Crystal Structure of the Broadly Neutralizing Anti-HIV Fab F105
PDB Compounds: (H:) f105 heavy chain

SCOP Domain Sequences for d1u6ah2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6ah2 b.1.1.2 (H:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOP Domain Coordinates for d1u6ah2:

Click to download the PDB-style file with coordinates for d1u6ah2.
(The format of our PDB-style files is described here.)

Timeline for d1u6ah2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u6ah1