Lineage for d1u6ah1 (1u6a H:2-113)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2017323Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2017500Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (33 PDB entries)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
  8. 2017550Domain d1u6ah1: 1u6a H:2-113 [119564]
    Other proteins in same PDB: d1u6ah2, d1u6al1, d1u6al2
    automatically matched to d1aqkh1

Details for d1u6ah1

PDB Entry: 1u6a (more details), 2.81 Å

PDB Description: Crystal Structure of the Broadly Neutralizing Anti-HIV Fab F105
PDB Compounds: (H:) f105 heavy chain

SCOPe Domain Sequences for d1u6ah1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6ah1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
vqlqesgpglvkpsetlsltctvsggsisshywswirqspgkglqwigyiyysgstnysp
slksrvtisvetaknqfslkltsmtaadtavyycargpvpavfygdyrldpwgqgtlvtv
ss

SCOPe Domain Coordinates for d1u6ah1:

Click to download the PDB-style file with coordinates for d1u6ah1.
(The format of our PDB-style files is described here.)

Timeline for d1u6ah1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u6ah2