Lineage for d1u63c1 (1u63 C:1-213)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2625308Fold e.24: Ribosomal protein L1 [56807] (1 superfamily)
    2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1)
  4. 2625309Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) (S)
    automatically mapped to Pfam PF00687
  5. 2625310Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein)
  6. 2625311Protein Ribosomal protein L1 [56810] (4 species)
  7. 2625312Species Methanococcus jannaschii [TaxId:2190] [56812] (3 PDB entries)
  8. 2625316Domain d1u63c1: 1u63 C:1-213 [119562]
    automatically matched to d1cjsa_
    protein/RNA complex

Details for d1u63c1

PDB Entry: 1u63 (more details), 3.4 Å

PDB Description: the structure of a ribosomal protein l1-mrna complex
PDB Compounds: (C:) 50s ribosomal protein l1p

SCOPe Domain Sequences for d1u63c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u63c1 e.24.1.1 (C:1-213) Ribosomal protein L1 {Methanococcus jannaschii [TaxId: 2190]}
mdreallqavkearelakprnftqsfefiatlkeidmrkpenriktevvlphgrgkeaki
avigtgdlakqaeelgltvirkeeieelgknkrklrkiakahdffiaqadlmpligrymg
vilgprgkmpkpvpananikplverlkktvvintrdkpyfqvlvgnekmtdeqivdniea
vlnvvakkyekglyhikdayvkltmgpavkvkk

SCOPe Domain Coordinates for d1u63c1:

Click to download the PDB-style file with coordinates for d1u63c1.
(The format of our PDB-style files is described here.)

Timeline for d1u63c1: