Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.24: Ribosomal protein L1 [56807] (1 superfamily) 2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1) |
Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) automatically mapped to Pfam PF00687 |
Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein) |
Protein Ribosomal protein L1 [56810] (4 species) |
Species Methanococcus jannaschii [TaxId:2190] [56812] (3 PDB entries) |
Domain d1u63c1: 1u63 C:1-213 [119562] automatically matched to d1cjsa_ protein/RNA complex |
PDB Entry: 1u63 (more details), 3.4 Å
SCOPe Domain Sequences for d1u63c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u63c1 e.24.1.1 (C:1-213) Ribosomal protein L1 {Methanococcus jannaschii [TaxId: 2190]} mdreallqavkearelakprnftqsfefiatlkeidmrkpenriktevvlphgrgkeaki avigtgdlakqaeelgltvirkeeieelgknkrklrkiakahdffiaqadlmpligrymg vilgprgkmpkpvpananikplverlkktvvintrdkpyfqvlvgnekmtdeqivdniea vlnvvakkyekglyhikdayvkltmgpavkvkk
Timeline for d1u63c1: