SCOPe 2.06: Domain d1u63a1: 1u63 A:1-213

Lineage for d1u63a1 (1u63 A:1-213)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.24: Ribosomal protein L1 [56807] (1 superfamily)
   2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1)

4. Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family)
   automatically mapped to Pfam PF00687

5. Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein)

6. Protein Ribosomal protein L1 [56810] (4 species)

7. Species Methanococcus jannaschii [TaxId:2190] [56812] (3 PDB entries)

8. Domain d1u63a1: 1u63 A:1-213 [119561]
   automatically matched to d1cjsa_
   protein/RNA complex

Details for d1u63a1

PDB Entry: 1u63, 3.4 Å

PDB Description: the structure of a ribosomal protein l1-mrna complex

PDB Compounds: (A:) 50s ribosomal protein l1p

SCOPe Domain Sequences for d1u63a1:

Sequence; same for both SEQRES and ATOM records:

>d1u63a1 e.24.1.1 (A:1-213) Ribosomal protein L1 {Methanococcus jannaschii [TaxId: 2190]}
mdreallqavkearelakprnftqsfefiatlkeidmrkpenriktevvlphgrgkeaki
avigtgdlakqaeelgltvirkeeieelgknkrklrkiakahdffiaqadlmpligrymg
vilgprgkmpkpvpananikplverlkktvvintrdkpyfqvlvgnekmtdeqivdniea
vlnvvakkyekglyhikdayvkltmgpavkvkk

Timeline for d1u63a1:

• d1u63a1 first appeared in SCOP 1.73
  
• d1u63a1 appears in SCOPe 2.05
  
• d1u63a1 appears in SCOPe 2.07
  
• d1u63a1 appears in the current release, SCOPe 2.08