![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.24: Ribosomal protein L1 [56807] (1 superfamily) 2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1) |
![]() | Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) ![]() automatically mapped to Pfam PF00687 |
![]() | Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein) |
![]() | Protein Ribosomal protein L1 [56810] (4 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [56812] (3 PDB entries) |
![]() | Domain d1u63a1: 1u63 A:1-213 [119561] automatically matched to d1cjsa_ protein/RNA complex |
PDB Entry: 1u63 (more details), 3.4 Å
SCOPe Domain Sequences for d1u63a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u63a1 e.24.1.1 (A:1-213) Ribosomal protein L1 {Methanococcus jannaschii [TaxId: 2190]} mdreallqavkearelakprnftqsfefiatlkeidmrkpenriktevvlphgrgkeaki avigtgdlakqaeelgltvirkeeieelgknkrklrkiakahdffiaqadlmpligrymg vilgprgkmpkpvpananikplverlkktvvintrdkpyfqvlvgnekmtdeqivdniea vlnvvakkyekglyhikdayvkltmgpavkvkk
Timeline for d1u63a1: