![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
![]() | Superfamily c.51.4: ITPase-like [52972] (3 families) ![]() formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
![]() | Family c.51.4.3: YjjX-like [110621] (2 proteins) Pfam PF01931 |
![]() | Protein Hypothetical protein YjjX [110622] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [142430] (1 PDB entry) Uniprot P39411 1-170 |
![]() | Domain d1u5wh1: 1u5w H:4-173 [119560] automatically matched to 1U5W A:4-173 complexed with so4 |
PDB Entry: 1u5w (more details), 2.3 Å
SCOP Domain Sequences for d1u5wh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u5wh1 c.51.4.3 (H:4-173) Hypothetical protein YjjX {Escherichia coli [TaxId: 562]} mhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarnrva narrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvregeal gpvmsrytgideigrkegaigvftagkltrasvyhqavilalspfhnavy
Timeline for d1u5wh1: