Lineage for d1u5wh1 (1u5w H:4-173)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 700602Fold c.51: Anticodon-binding domain-like [52953] (5 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 700764Superfamily c.51.4: ITPase-like [52972] (3 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 700804Family c.51.4.3: YjjX-like [110621] (2 proteins)
    Pfam PF01931
  6. 700813Protein Hypothetical protein YjjX [110622] (2 species)
  7. 700814Species Escherichia coli [TaxId:562] [142430] (1 PDB entry)
  8. 700822Domain d1u5wh1: 1u5w H:4-173 [119560]
    automatically matched to 1U5W A:4-173
    complexed with so4

Details for d1u5wh1

PDB Entry: 1u5w (more details), 2.3 Å

PDB Description: crystal structure of hypothetical protein yjjx from escherichia coli
PDB Compounds: (H:) Hypothetical UPF0244 protein yjjX

SCOP Domain Sequences for d1u5wh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5wh1 c.51.4.3 (H:4-173) Hypothetical protein YjjX {Escherichia coli [TaxId: 562]}
mhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarnrva
narrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvregeal
gpvmsrytgideigrkegaigvftagkltrasvyhqavilalspfhnavy

SCOP Domain Coordinates for d1u5wh1:

Click to download the PDB-style file with coordinates for d1u5wh1.
(The format of our PDB-style files is described here.)

Timeline for d1u5wh1: