SCOPe 2.08: Domain d1u5wf2: 1u5w F:4-173

Lineage for d1u5wf2 (1u5w F:4-173)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.3: YjjX-like [110621] (2 proteins)
   Pfam PF01931

6. Protein Hypothetical protein YjjX [110622] (2 species)

7. Species Escherichia coli [TaxId:562] [142430] (1 PDB entry)
   Uniprot P39411 1-170

8. Domain d1u5wf2: 1u5w F:4-173 [119558]
   Other proteins in same PDB: d1u5wa2, d1u5wb3, d1u5wb4, d1u5wc3, d1u5wc4, d1u5wd3, d1u5wd4, d1u5we3, d1u5we4, d1u5wf3, d1u5wg3, d1u5wg4
   automated match to d1u14a_
   complexed with so4

Details for d1u5wf2

PDB Entry: 1u5w, 2.3 Å

PDB Description: crystal structure of hypothetical protein yjjx from escherichia coli

PDB Compounds: (F:) Hypothetical UPF0244 protein yjjX

SCOPe Domain Sequences for d1u5wf2:

Sequence; same for both SEQRES and ATOM records:

>d1u5wf2 c.51.4.3 (F:4-173) Hypothetical protein YjjX {Escherichia coli [TaxId: 562]}
mhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarnrva
narrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvregeal
gpvmsrytgideigrkegaigvftagkltrasvyhqavilalspfhnavy

Timeline for d1u5wf2:

• d1u5wf2 first appeared in SCOP 1.73, called d1u5wf1
  
• d1u5wf2 appears in SCOPe 2.07