Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.4: ITPase-like [52972] (4 families) formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
Family c.51.4.3: YjjX-like [110621] (2 proteins) Pfam PF01931 |
Protein Hypothetical protein YjjX [110622] (2 species) |
Species Escherichia coli [TaxId:562] [142430] (1 PDB entry) Uniprot P39411 1-170 |
Domain d1u5wc_: 1u5w C: [119555] automated match to d1u14a_ complexed with so4 |
PDB Entry: 1u5w (more details), 2.3 Å
SCOPe Domain Sequences for d1u5wc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u5wc_ c.51.4.3 (C:) Hypothetical protein YjjX {Escherichia coli [TaxId: 562]} limhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarnr vanarrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvrege algpvmsrytgideigrkegaigvftagkltrasvyhqavilalspfhnavysg
Timeline for d1u5wc_: