SCOPe 2.05: Domain d1u5wc_: 1u5w C:

Lineage for d1u5wc_ (1u5w C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.3: YjjX-like [110621] (2 proteins)
   Pfam PF01931

6. Protein Hypothetical protein YjjX [110622] (2 species)

7. Species Escherichia coli [TaxId:562] [142430] (1 PDB entry)
   Uniprot P39411 1-170

8. Domain d1u5wc_: 1u5w C: [119555]
   automated match to d1u14a_
   complexed with so4

Details for d1u5wc_

PDB Entry: 1u5w, 2.3 Å

PDB Description: crystal structure of hypothetical protein yjjx from escherichia coli

PDB Compounds: (C:) Hypothetical UPF0244 protein yjjX

SCOPe Domain Sequences for d1u5wc_:

Sequence; same for both SEQRES and ATOM records:

>d1u5wc_ c.51.4.3 (C:) Hypothetical protein YjjX {Escherichia coli [TaxId: 562]}
limhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarnr
vanarrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvrege
algpvmsrytgideigrkegaigvftagkltrasvyhqavilalspfhnavysg

Timeline for d1u5wc_:

• d1u5wc_ first appeared in SCOP 1.73, called d1u5wc1
  
• d1u5wc_ appears in SCOPe 2.04
  
• d1u5wc_ is called d1u5wc2 in SCOPe 2.06
  
• d1u5wc_ appears in the current release, SCOPe 2.08, called d1u5wc2