Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.4: ITPase-like [52972] (4 families) formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
Family c.51.4.3: YjjX-like [110621] (2 proteins) Pfam PF01931 |
Protein Hypothetical protein YjjX [110622] (2 species) |
Species Escherichia coli [TaxId:562] [142430] (1 PDB entry) Uniprot P39411 1-170 |
Domain d1u5wa1: 1u5w A:4-173 [119553] Other proteins in same PDB: d1u5wa2, d1u5wb3, d1u5wb4, d1u5wc3, d1u5wc4, d1u5wd3, d1u5wd4, d1u5we3, d1u5we4, d1u5wf3, d1u5wg3, d1u5wg4 complexed with so4 |
PDB Entry: 1u5w (more details), 2.3 Å
SCOPe Domain Sequences for d1u5wa1:
Sequence, based on SEQRES records: (download)
>d1u5wa1 c.51.4.3 (A:4-173) Hypothetical protein YjjX {Escherichia coli [TaxId: 562]} mhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarnrva narrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvregeal gpvmsrytgideigrkegaigvftagkltrasvyhqavilalspfhnavy
>d1u5wa1 c.51.4.3 (A:4-173) Hypothetical protein YjjX {Escherichia coli [TaxId: 562]} mhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarnrva narrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvregeal gpvmsryegaigvftagkltrasvyhqavilalspfhnavy
Timeline for d1u5wa1: