Lineage for d1u5wa1 (1u5w A:4-173)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2882121Superfamily c.51.4: ITPase-like [52972] (4 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 2882167Family c.51.4.3: YjjX-like [110621] (2 proteins)
    Pfam PF01931
  6. 2882171Protein Hypothetical protein YjjX [110622] (2 species)
  7. 2882172Species Escherichia coli [TaxId:562] [142430] (1 PDB entry)
    Uniprot P39411 1-170
  8. 2882173Domain d1u5wa1: 1u5w A:4-173 [119553]
    Other proteins in same PDB: d1u5wa2, d1u5wb3, d1u5wb4, d1u5wc3, d1u5wc4, d1u5wd3, d1u5wd4, d1u5we3, d1u5we4, d1u5wf3, d1u5wg3, d1u5wg4
    complexed with so4

Details for d1u5wa1

PDB Entry: 1u5w (more details), 2.3 Å

PDB Description: crystal structure of hypothetical protein yjjx from escherichia coli
PDB Compounds: (A:) Hypothetical UPF0244 protein yjjX

SCOPe Domain Sequences for d1u5wa1:

Sequence, based on SEQRES records: (download)

>d1u5wa1 c.51.4.3 (A:4-173) Hypothetical protein YjjX {Escherichia coli [TaxId: 562]}
mhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarnrva
narrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvregeal
gpvmsrytgideigrkegaigvftagkltrasvyhqavilalspfhnavy

Sequence, based on observed residues (ATOM records): (download)

>d1u5wa1 c.51.4.3 (A:4-173) Hypothetical protein YjjX {Escherichia coli [TaxId: 562]}
mhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarnrva
narrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvregeal
gpvmsryegaigvftagkltrasvyhqavilalspfhnavy

SCOPe Domain Coordinates for d1u5wa1:

Click to download the PDB-style file with coordinates for d1u5wa1.
(The format of our PDB-style files is described here.)

Timeline for d1u5wa1: