Lineage for d1u5sb2 (1u5s B:103-137)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640292Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2640293Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2640448Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 2640545Protein Pinch (particularly interesting new Cys-His) protein [57741] (1 species)
  7. 2640546Species Human (Homo sapiens) [TaxId:9606] [57742] (5 PDB entries)
  8. 2640550Domain d1u5sb2: 1u5s B:103-137 [119552]
    Other proteins in same PDB: d1u5sa1, d1u5sb3
    automated match to d1u5sb2
    complexed with zn

Details for d1u5sb2

PDB Entry: 1u5s (more details)

PDB Description: nmr structure of the complex between nck-2 sh3 domain and pinch-1 lim4 domain
PDB Compounds: (B:) PINCH protein

SCOPe Domain Sequences for d1u5sb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]}
fvcakcekpflghrhyerkglaycethynqlfgdv

SCOPe Domain Coordinates for d1u5sb2:

Click to download the PDB-style file with coordinates for d1u5sb2.
(The format of our PDB-style files is described here.)

Timeline for d1u5sb2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1u5sa1