![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.3: LIM domain [57736] (18 proteins) duplication: contains two (sub)domains of this fold |
![]() | Protein Pinch (particularly interesting new Cys-His) protein [57741] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57742] (5 PDB entries) |
![]() | Domain d1u5sb2: 1u5s B:103-137 [119552] Other proteins in same PDB: d1u5sa1, d1u5sb3 automated match to d1u5sb2 complexed with zn |
PDB Entry: 1u5s (more details)
SCOPe Domain Sequences for d1u5sb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} fvcakcekpflghrhyerkglaycethynqlfgdv
Timeline for d1u5sb2: