SCOP 1.75: Domain d1u5sb2: 1u5s B:103-137

Lineage for d1u5sb2 (1u5s B:103-137)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families)

5. Family g.39.1.3: LIM domain [57736] (18 proteins)
   duplication: contains two (sub)domains of this fold

6. Protein Pinch (particularly interesting new Cys-His) protein [57741] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57742] (5 PDB entries)

8. Domain d1u5sb2: 1u5s B:103-137 [119552]
   Other proteins in same PDB: d1u5sa1
   automatically matched to d1nypa2
   complexed with zn

Details for d1u5sb2

PDB Entry: 1u5s

PDB Description: nmr structure of the complex between nck-2 sh3 domain and pinch-1 lim4 domain

PDB Compounds: (B:) PINCH protein

SCOP Domain Sequences for d1u5sb2:

Sequence; same for both SEQRES and ATOM records:

>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]}
fvcakcekpflghrhyerkglaycethynqlfgdv

Timeline for d1u5sb2:

• d1u5sb2 first appeared in SCOP 1.73
  
• d1u5sb2 appears in SCOPe 2.01
  
• d1u5sb2 appears in the current release, SCOPe 2.08