Lineage for d1u5ib_ (1u5i B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1997611Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)
  6. 1997625Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)
  7. 1997642Species Norway rat (Rattus norvegicus) [TaxId:10116] [47554] (8 PDB entries)
  8. 1997651Domain d1u5ib_: 1u5i B: [119550]
    Other proteins in same PDB: d1u5ia1, d1u5ia2, d1u5ia3
    automated match to d1df0b_
    mutant

Details for d1u5ib_

PDB Entry: 1u5i (more details), 2.86 Å

PDB Description: crystal structure analysis of rat m-calpain mutant lys10 thr
PDB Compounds: (B:) Calpain small subunit 1

SCOPe Domain Sequences for d1u5ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5ib_ a.39.1.8 (B:) Calpain small (regulatory) subunit (domain VI) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
neseeerqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmd
sdttgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysm
iirrysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlqltmys

SCOPe Domain Coordinates for d1u5ib_:

Click to download the PDB-style file with coordinates for d1u5ib_.
(The format of our PDB-style files is described here.)

Timeline for d1u5ib_: