SCOPe 2.05: Domain d1u5ib_: 1u5i B:

Lineage for d1u5ib_ (1u5i B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)

6. Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [47554] (8 PDB entries)

8. Domain d1u5ib_: 1u5i B: [119550]
   Other proteins in same PDB: d1u5ia1, d1u5ia2, d1u5ia3
   automated match to d1df0b_
   mutant

Details for d1u5ib_

PDB Entry: 1u5i, 2.86 Å

PDB Description: crystal structure analysis of rat m-calpain mutant lys10 thr

PDB Compounds: (B:) Calpain small subunit 1

SCOPe Domain Sequences for d1u5ib_:

Sequence; same for both SEQRES and ATOM records:

>d1u5ib_ a.39.1.8 (B:) Calpain small (regulatory) subunit (domain VI) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
neseeerqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmd
sdttgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysm
iirrysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlqltmys

Timeline for d1u5ib_:

• d1u5ib_ first appeared in SCOP 1.73, called d1u5ib1
  
• d1u5ib_ appears in SCOPe 2.04
  
• d1u5ib_ appears in SCOPe 2.06
  
• d1u5ib_ appears in the current release, SCOPe 2.08