![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins) |
![]() | Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [47554] (8 PDB entries) |
![]() | Domain d1u5ib_: 1u5i B: [119550] Other proteins in same PDB: d1u5ia1, d1u5ia2, d1u5ia3 automated match to d1df0b_ mutant |
PDB Entry: 1u5i (more details), 2.86 Å
SCOPe Domain Sequences for d1u5ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u5ib_ a.39.1.8 (B:) Calpain small (regulatory) subunit (domain VI) {Norway rat (Rattus norvegicus) [TaxId: 10116]} neseeerqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmd sdttgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysm iirrysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlqltmys
Timeline for d1u5ib_: