Lineage for d1u5ia3 (1u5i A:2-355)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155026Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)
    automatically mapped to Pfam PF00648
  6. 2155027Protein Calpain large subunit, catalytic domain (domain II) [54041] (6 species)
    includes the N-terminal 'sequence' domain I
  7. 2155040Species Norway rat (Rattus norvegicus), M-type [TaxId:10116] [54043] (3 PDB entries)
  8. 2155044Domain d1u5ia3: 1u5i A:2-355 [119549]
    Other proteins in same PDB: d1u5ia1, d1u5ia2, d1u5ib_
    automatically matched to d1df0a3
    mutant

Details for d1u5ia3

PDB Entry: 1u5i (more details), 2.86 Å

PDB Description: Crystal Structure analysis of rat m-calpain mutant Lys10 Thr
PDB Compounds: (A:) Calpain 2, large [catalytic] subunit precursor

SCOPe Domain Sequences for d1u5ia3:

Sequence, based on SEQRES records: (download)

>d1u5ia3 d.3.1.3 (A:2-355) Calpain large subunit, catalytic domain (domain II) {Norway rat (Rattus norvegicus), M-type [TaxId: 10116]}
agiamklatdreaaeglgsheraikylnqdyetlrnecleagalfqdpsfpalpsslgfk
elgpyssktrgiewkrpteicadpqfiiggatrtdicqgalgdswllaaiasltlneeil
arvvpldqsfqenyagifhfqfwqygewvevvvddrlptkdgellfvhsaegsefwsall
ekayakingcyealsggattegfedftggiaewyelrkpppnlfkiiqkalekgsllgcs
iditsaadseavtyqklvkghaysvtgaeevessgslqklirirnpwgqvewtgkwndnc
pswntvdpevranlterqedgefwmsfsdflrhysrleicnltpdtltcdsykk

Sequence, based on observed residues (ATOM records): (download)

>d1u5ia3 d.3.1.3 (A:2-355) Calpain large subunit, catalytic domain (domain II) {Norway rat (Rattus norvegicus), M-type [TaxId: 10116]}
agiamklatdreaaeglgsheraikylnqdyetlrnecleagalfqdpsfpalpsslgfk
elgpyssktrgiewkrpteicadpqfiiggatrtdicqgalgdswllaaiasltlneeil
arvvpldqsfqenyagifhfqfwqygewvevvvddrlptkdgellfvhsaegsefwsall
ekayakingcyealsggattegfedftggiaewyelrkpppnlfkiiqkalekgsllgcs
idighaysvtgaeevqklirirnpwgqgefwmsfsdflrhysrleicnltpdtltcdsyk
k

SCOPe Domain Coordinates for d1u5ia3:

Click to download the PDB-style file with coordinates for d1u5ia3.
(The format of our PDB-style files is described here.)

Timeline for d1u5ia3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1u5ib_