Lineage for d1u5ia2 (1u5i A:356-514)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1529978Fold b.14: Calpain large subunit, middle domain (domain III) [49757] (1 superfamily)
    sandwich; 8 strands in 2 sheets; jelly-roll
  4. 1529979Superfamily b.14.1: Calpain large subunit, middle domain (domain III) [49758] (1 family) (S)
    automatically mapped to Pfam PF01067
  5. 1529980Family b.14.1.1: Calpain large subunit, middle domain (domain III) [49759] (1 protein)
  6. 1529981Protein Calpain large subunit, middle domain (domain III) [49760] (3 species)
  7. 1529985Species Norway rat (Rattus norvegicus), M-type [TaxId:10116] [49762] (2 PDB entries)
  8. 1529987Domain d1u5ia2: 1u5i A:356-514 [119548]
    Other proteins in same PDB: d1u5ia1, d1u5ia3, d1u5ib_
    automatically matched to d1df0a2
    mutant

Details for d1u5ia2

PDB Entry: 1u5i (more details), 2.86 Å

PDB Description: crystal structure analysis of rat m-calpain mutant lys10 thr
PDB Compounds: (A:) Calpain 2, large [catalytic] subunit precursor

SCOPe Domain Sequences for d1u5ia2:

Sequence, based on SEQRES records: (download)

>d1u5ia2 b.14.1.1 (A:356-514) Calpain large subunit, middle domain (domain III) {Norway rat (Rattus norvegicus), M-type [TaxId: 10116]}
wkltkmdgnwrrgstaggcrnypntfwmnpqylikleeededdedgergctflvgliqkh
rrrqrkmgedmhtigfgiyevpeeltgqtnihlsknfflttrarersdtfinlrevlnrf
klppgeyvlvpstfephkngdfcirvfsekkadyqtvdd

Sequence, based on observed residues (ATOM records): (download)

>d1u5ia2 b.14.1.1 (A:356-514) Calpain large subunit, middle domain (domain III) {Norway rat (Rattus norvegicus), M-type [TaxId: 10116]}
wkltkmdgnwrrgstaggcrnypntfwmnpqylikleeededdedgergctflvgliqkh
rrrqrkmgedmhtigfgiyevsknffltersdtfinlrevlnrfklppgeyvlvpstfep
hkngdfcirvfsekkadyqtvdd

SCOPe Domain Coordinates for d1u5ia2:

Click to download the PDB-style file with coordinates for d1u5ia2.
(The format of our PDB-style files is described here.)

Timeline for d1u5ia2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1u5ib_