Lineage for d1u5ia1 (1u5i A:515-700)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711466Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)
  6. 2711470Protein Calpain large subunit, C-terminal domain (domain IV) [47556] (3 species)
  7. 2711474Species Norway rat (Rattus norvegicus), M-type [TaxId:10116] [47558] (2 PDB entries)
  8. 2711475Domain d1u5ia1: 1u5i A:515-700 [119547]
    Other proteins in same PDB: d1u5ia2, d1u5ia3, d1u5ib_
    automatically matched to d1df0a1
    mutant

Details for d1u5ia1

PDB Entry: 1u5i (more details), 2.86 Å

PDB Description: crystal structure analysis of rat m-calpain mutant lys10 thr
PDB Compounds: (A:) Calpain 2, large [catalytic] subunit precursor

SCOPe Domain Sequences for d1u5ia1:

Sequence, based on SEQRES records: (download)

>d1u5ia1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Norway rat (Rattus norvegicus), M-type [TaxId: 10116]}
eieanieeieaneedigdgfrrlfaqlagedaeisafelqtilrrvlakrediksdgfsi
etckimvdmldedgsgklglkefyilwtkiqkyqkiyreidvdrsgtmnsyemrkaleea
gfklpcqlhqvivarfaddeliidfdnfvrclvrleilfkifkqldpentgtiqldlisw
lsfsvl

Sequence, based on observed residues (ATOM records): (download)

>d1u5ia1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Norway rat (Rattus norvegicus), M-type [TaxId: 10116]}
eieanieeianeedigdgfrrlfaqlagedaeisafelqtilrrvlakksdgfsietcki
mvdmldedgsgklglkefyilwtkiqkyqkiyreidvdrsgtmnsyemrkaleeagfklp
cqlhqvivarfaddeliidfdnfvrclvrleilfkifkqldpentgtiqldliswlsfsv
l

SCOPe Domain Coordinates for d1u5ia1:

Click to download the PDB-style file with coordinates for d1u5ia1.
(The format of our PDB-style files is described here.)

Timeline for d1u5ia1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1u5ib_