Class b: All beta proteins [48724] (176 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
Protein Src-associated adaptor protein Skap2 [141417] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [141418] (4 PDB entries) Uniprot Q9Z2K4 105-212! Uniprot Q9Z2K4 109-219! Uniprot Q9Z2K4 14-222 |
Domain d1u5gc_: 1u5g C: [119545] automated match to d1u5ga1 |
PDB Entry: 1u5g (more details), 2.1 Å
SCOPe Domain Sequences for d1u5gc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u5gc_ b.55.1.1 (C:) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} qfppiaaqdlpfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqqkgef aidgydvrmnntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilqdlg
Timeline for d1u5gc_: