Lineage for d1u5gc1 (1u5g C:105-219)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672997Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 672998Superfamily b.55.1: PH domain-like [50729] (12 families) (S)
  5. 672999Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (43 proteins)
    Pfam PF00169
  6. 673188Protein Src-associated adaptor protein Skap2 [141417] (1 species)
  7. 673189Species Mouse (Mus musculus) [TaxId:10090] [141418] (4 PDB entries)
  8. 673193Domain d1u5gc1: 1u5g C:105-219 [119545]
    automatically matched to 1U5G A:105-219
    mutant

Details for d1u5gc1

PDB Entry: 1u5g (more details), 2.1 Å

PDB Description: crystal structure of the ph domain of skap-hom
PDB Compounds: (C:) Src-associated adaptor protein

SCOP Domain Sequences for d1u5gc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5gc1 b.55.1.1 (C:105-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]}
qfppiaaqdlpfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqqkgef
aidgydvrmnntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilq

SCOP Domain Coordinates for d1u5gc1:

Click to download the PDB-style file with coordinates for d1u5gc1.
(The format of our PDB-style files is described here.)

Timeline for d1u5gc1: