Lineage for d1u5fa1 (1u5f A:109-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803309Protein Src-associated adaptor protein Skap2 [141417] (1 species)
  7. 2803310Species Mouse (Mus musculus) [TaxId:10090] [141418] (4 PDB entries)
    Uniprot Q9Z2K4 105-212! Uniprot Q9Z2K4 109-219! Uniprot Q9Z2K4 14-222
  8. 2803311Domain d1u5fa1: 1u5f A:109-219 [119542]
    complexed with so4

Details for d1u5fa1

PDB Entry: 1u5f (more details), 1.9 Å

PDB Description: crystal structure of the ph domain of skap-hom with 8 vector-derived n-terminal residues
PDB Compounds: (A:) Src-associated adaptor protein

SCOPe Domain Sequences for d1u5fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]}
ipaqdlpfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqqkgefaidg
ydvrmnntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilq

SCOPe Domain Coordinates for d1u5fa1:

Click to download the PDB-style file with coordinates for d1u5fa1.
(The format of our PDB-style files is described here.)

Timeline for d1u5fa1: