SCOPe 2.06: Domain d1u5eb_: 1u5e B:

Lineage for d1u5eb_ (1u5e B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Src-associated adaptor protein Skap2 [141417] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [141418] (4 PDB entries)
   Uniprot Q9Z2K4 105-212! Uniprot Q9Z2K4 109-219! Uniprot Q9Z2K4 14-222

8. Domain d1u5eb_: 1u5e B: [119541]
   automated match to d1u5ea1

Details for d1u5eb_

PDB Entry: 1u5e, 2.6 Å

PDB Description: crystal structure of a n-terminal fragment of skap-hom containing both the helical dimerization domain and the ph domain

PDB Compounds: (B:) Src-associated adaptor protein

SCOPe Domain Sequences for d1u5eb_:

Sequence, based on SEQRES records:

>d1u5eb_ b.55.1.1 (B:) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]}
peeirnlladvetfvadtlkgenlskkakekreslikkikdvksvylqefqdkgdaedgd
eyddpfagpadtislaserydkdddgpsdgnqfppiaaqdlpfvikagylekrrkdhsfl
gfewqkrwcalsktvfyyygsdkdkqqkgefaidgydvrmnntlrkdgkkdccfeicapd
kriyqftaaspkdaeewvqqlkfilqdlg

Sequence, based on observed residues (ATOM records):

>d1u5eb_ b.55.1.1 (B:) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]}
peeirnlladvetfvadtlkgenlskkakekreslikkikdvksvylqefqfppiaaqdl
pfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqqkgefaidgydvrmn
ntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilqdlg

Timeline for d1u5eb_:

• d1u5eb_ first appeared in SCOP 1.73, called d1u5eb1
  
• d1u5eb_ appears in SCOPe 2.05
  
• d1u5eb_ appears in SCOPe 2.07
  
• d1u5eb_ appears in the current release, SCOPe 2.08