Lineage for d1u5eb1 (1u5e B:14-222)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672997Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 672998Superfamily b.55.1: PH domain-like [50729] (12 families) (S)
  5. 672999Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (43 proteins)
    Pfam PF00169
  6. 673188Protein Src-associated adaptor protein Skap2 [141417] (1 species)
  7. 673189Species Mouse (Mus musculus) [TaxId:10090] [141418] (4 PDB entries)
  8. 673196Domain d1u5eb1: 1u5e B:14-222 [119541]
    automatically matched to 1U5E A:14-222
    mutant

Details for d1u5eb1

PDB Entry: 1u5e (more details), 2.6 Å

PDB Description: crystal structure of a n-terminal fragment of skap-hom containing both the helical dimerization domain and the ph domain
PDB Compounds: (B:) Src-associated adaptor protein

SCOP Domain Sequences for d1u5eb1:

Sequence, based on SEQRES records: (download)

>d1u5eb1 b.55.1.1 (B:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]}
peeirnlladvetfvadtlkgenlskkakekreslikkikdvksvylqefqdkgdaedgd
eyddpfagpadtislaserydkdddgpsdgnqfppiaaqdlpfvikagylekrrkdhsfl
gfewqkrwcalsktvfyyygsdkdkqqkgefaidgydvrmnntlrkdgkkdccfeicapd
kriyqftaaspkdaeewvqqlkfilqdlg

Sequence, based on observed residues (ATOM records): (download)

>d1u5eb1 b.55.1.1 (B:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]}
peeirnlladvetfvadtlkgenlskkakekreslikkikdvksvylqefqfppiaaqdl
pfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqqkgefaidgydvrmn
ntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilqdlg

SCOP Domain Coordinates for d1u5eb1:

Click to download the PDB-style file with coordinates for d1u5eb1.
(The format of our PDB-style files is described here.)

Timeline for d1u5eb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1u5ea1