SCOP 1.73: Domain d1u5ea1: 1u5e A:14-222

Lineage for d1u5ea1 (1u5e A:14-222)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (12 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (43 proteins)
   Pfam PF00169

6. Protein Src-associated adaptor protein Skap2 [141417] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [141418] (4 PDB entries)

8. Domain d1u5ea1: 1u5e A:14-222 [119540]
   includes extra N-terminal alpha-hairpin, dimerisation subdomain
   mutant

Details for d1u5ea1

PDB Entry: 1u5e, 2.6 Å

PDB Description: crystal structure of a n-terminal fragment of skap-hom containing both the helical dimerization domain and the ph domain

PDB Compounds: (A:) Src-associated adaptor protein

SCOP Domain Sequences for d1u5ea1:

Sequence, based on SEQRES records:

>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]}
peeirnlladvetfvadtlkgenlskkakekreslikkikdvksvylqefqdkgdaedgd
eyddpfagpadtislaserydkdddgpsdgnqfppiaaqdlpfvikagylekrrkdhsfl
gfewqkrwcalsktvfyyygsdkdkqqkgefaidgydvrmnntlrkdgkkdccfeicapd
kriyqftaaspkdaeewvqqlkfilqdlg

Sequence, based on observed residues (ATOM records):

>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]}
peeirnlladvetfvadtlkgenlskkakekreslikkikdvksvylqefqfppiaaqdl
pfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqqkgefaidgydvrmn
ntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilqdlg

Timeline for d1u5ea1:

• d1u5ea1 is new in SCOP 1.73
  
• d1u5ea1 appears in SCOP 1.75
  
• d1u5ea1 appears in the current release, SCOPe 2.08