Lineage for d1u5dd_ (1u5d D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798838Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1798839Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1798840Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 1799052Protein Src kinase-associated phosphoprotein SKAP55 (SCAP1) [141403] (1 species)
  7. 1799053Species Human (Homo sapiens) [TaxId:9606] [141404] (1 PDB entry)
    Uniprot O15268 108-213
  8. 1799057Domain d1u5dd_: 1u5d D: [119539]
    automated match to d1u5da1
    complexed with so4

Details for d1u5dd_

PDB Entry: 1u5d (more details), 1.7 Å

PDB Description: crystal structure of the ph domain of skap55
PDB Compounds: (D:) Src Kinase-associated Phosphoprotein of 55 kDa

SCOPe Domain Sequences for d1u5dd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5dd_ b.55.1.1 (D:) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]}
gsvikqgylekkskdhsffgsewqkrwcvvsrglfyyyanekskqpkgtflikgysvrma
phlrrdskkescfeltsqdrrtyeftatspaeardwvdqisfllkdls

SCOPe Domain Coordinates for d1u5dd_:

Click to download the PDB-style file with coordinates for d1u5dd_.
(The format of our PDB-style files is described here.)

Timeline for d1u5dd_: