SCOP 1.73: Domain d1u5dd1: 1u5d D:108-213

Lineage for d1u5dd1 (1u5d D:108-213)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (12 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (43 proteins)
   Pfam PF00169

6. Protein Src kinase-associated phosphoprotein SKAP55 (SCAP1) [141403] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141404] (1 PDB entry)

8. Domain d1u5dd1: 1u5d D:108-213 [119539]
   automatically matched to 1U5D A:108-213
   complexed with so4; mutant

Details for d1u5dd1

PDB Entry: 1u5d, 1.7 Å

PDB Description: crystal structure of the ph domain of skap55

PDB Compounds: (D:) Src Kinase-associated Phosphoprotein of 55 kDa

SCOP Domain Sequences for d1u5dd1:

Sequence; same for both SEQRES and ATOM records:

>d1u5dd1 b.55.1.1 (D:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]}
vikqgylekkskdhsffgsewqkrwcvvsrglfyyyanekskqpkgtflikgysvrmaph
lrrdskkescfeltsqdrrtyeftatspaeardwvdqisfllkdls

Timeline for d1u5dd1:

• d1u5dd1 is new in SCOP 1.73
  
• d1u5dd1 appears in SCOP 1.75
  
• d1u5dd1 appears in the current release, SCOPe 2.08, called d1u5dd_