![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
![]() | Protein Src kinase-associated phosphoprotein SKAP55 (SCAP1) [141403] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141404] (1 PDB entry) Uniprot O15268 108-213 |
![]() | Domain d1u5dd_: 1u5d D: [119539] automated match to d1u5da1 complexed with so4 |
PDB Entry: 1u5d (more details), 1.7 Å
SCOPe Domain Sequences for d1u5dd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u5dd_ b.55.1.1 (D:) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} gsvikqgylekkskdhsffgsewqkrwcvvsrglfyyyanekskqpkgtflikgysvrma phlrrdskkescfeltsqdrrtyeftatspaeardwvdqisfllkdls
Timeline for d1u5dd_: