Lineage for d1u5db1 (1u5d B:108-212)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805150Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 805151Superfamily b.55.1: PH domain-like [50729] (13 families) (S)
  5. 805152Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (47 proteins)
    Pfam PF00169
  6. 805365Protein Src kinase-associated phosphoprotein SKAP55 (SCAP1) [141403] (1 species)
  7. 805366Species Human (Homo sapiens) [TaxId:9606] [141404] (1 PDB entry)
    Uniprot O15268 108-213
  8. 805368Domain d1u5db1: 1u5d B:108-212 [119537]
    automatically matched to 1U5D A:108-213
    complexed with so4; mutant

Details for d1u5db1

PDB Entry: 1u5d (more details), 1.7 Å

PDB Description: crystal structure of the ph domain of skap55
PDB Compounds: (B:) Src Kinase-associated Phosphoprotein of 55 kDa

SCOP Domain Sequences for d1u5db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5db1 b.55.1.1 (B:108-212) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]}
vikqgylekkskdhsffgsewqkrwcvvsrglfyyyanekskqpkgtflikgysvrmaph
lrrdskkescfeltsqdrrtyeftatspaeardwvdqisfllkdl

SCOP Domain Coordinates for d1u5db1:

Click to download the PDB-style file with coordinates for d1u5db1.
(The format of our PDB-style files is described here.)

Timeline for d1u5db1: