Class b: All beta proteins [48724] (174 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (13 families) |
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (47 proteins) Pfam PF00169 |
Protein Src kinase-associated phosphoprotein SKAP55 (SCAP1) [141403] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141404] (1 PDB entry) Uniprot O15268 108-213 |
Domain d1u5da1: 1u5d A:108-213 [119536] complexed with so4; mutant |
PDB Entry: 1u5d (more details), 1.7 Å
SCOP Domain Sequences for d1u5da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} vikqgylekkskdhsffgsewqkrwcvvsrglfyyyanekskqpkgtflikgysvrmaph lrrdskkescfeltsqdrrtyeftatspaeardwvdqisfllkdls
Timeline for d1u5da1: