![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
![]() | Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
![]() | Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
![]() | Protein Lactate dehydrogenase [56339] (20 species) |
![]() | Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [56343] (14 PDB entries) |
![]() | Domain d1u5aa2: 1u5a A:165-329 [119533] Other proteins in same PDB: d1u5aa1, d1u5aa3 automated match to d1t2da2 complexed with bik |
PDB Entry: 1u5a (more details), 1.8 Å
SCOPe Domain Sequences for d1u5aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u5aa2 d.162.1.1 (A:165-329) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} gvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnklisd aeleaifdrtvntaleivnlhaspyvapaaaiiemaesylkdlkkvlicstllegqyghs difggtpvvlgangveqvielqlnseekakfdeaiaetkrmkala
Timeline for d1u5aa2: