![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
![]() | Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) ![]() |
![]() | Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) |
![]() | Protein Lactate dehydrogenase [56339] (15 species) |
![]() | Species Plasmodium berghei [TaxId:5821] [103325] (7 PDB entries) |
![]() | Domain d1u5aa2: 1u5a A:164-328 [119533] Other proteins in same PDB: d1u5aa1 automatically matched to d1oc4a2 complexed with bik |
PDB Entry: 1u5a (more details), 1.8 Å
SCOP Domain Sequences for d1u5aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u5aa2 d.162.1.1 (A:164-328) Lactate dehydrogenase {Plasmodium berghei [TaxId: 5821]} ggvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnklis daeleaifdrtvntaleivnlhaspyvapaaaiiemaesylkdlkkvlicstllegqygh sdifggtpvvlgangveqvielqlnseekakfdeaiaetkrmkal
Timeline for d1u5aa2: