Lineage for d1u5aa2 (1u5a A:165-329)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2556797Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2556804Protein Lactate dehydrogenase [56339] (20 species)
  7. 2556987Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [56343] (14 PDB entries)
  8. 2556991Domain d1u5aa2: 1u5a A:165-329 [119533]
    Other proteins in same PDB: d1u5aa1, d1u5aa3
    automated match to d1t2da2
    complexed with bik

Details for d1u5aa2

PDB Entry: 1u5a (more details), 1.8 Å

PDB Description: Plasmodium falciparum lactate dehydrogenase complexed with 3,5-dihydroxy-2-naphthoic acid
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1u5aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5aa2 d.162.1.1 (A:165-329) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
gvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnklisd
aeleaifdrtvntaleivnlhaspyvapaaaiiemaesylkdlkkvlicstllegqyghs
difggtpvvlgangveqvielqlnseekakfdeaiaetkrmkala

SCOPe Domain Coordinates for d1u5aa2:

Click to download the PDB-style file with coordinates for d1u5aa2.
(The format of our PDB-style files is described here.)

Timeline for d1u5aa2: