Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein automated matches [226882] (10 species) not a true protein |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [254909] (5 PDB entries) |
Domain d1u4sa2: 1u4s A:165-329 [119530] Other proteins in same PDB: d1u4sa1, d1u4sa3 automated match to d1t2da2 complexed with bih |
PDB Entry: 1u4s (more details), 2 Å
SCOPe Domain Sequences for d1u4sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u4sa2 d.162.1.1 (A:165-329) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} gvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnklisd aeleaifdrtvntaleivnlhaspyvapaaaiiemaesylkdlkkvlicstllegqyghs difggtpvvlgangveqvielqlnseekakfdeaiaetkrmkala
Timeline for d1u4sa2: