Lineage for d1u4sa1 (1u4s A:18-164)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1579036Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1579368Protein automated matches [226881] (6 species)
    not a true protein
  7. 1579403Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [254908] (5 PDB entries)
  8. 1579407Domain d1u4sa1: 1u4s A:18-164 [119529]
    Other proteins in same PDB: d1u4sa2
    automated match to d1t2da1
    complexed with bih

Details for d1u4sa1

PDB Entry: 1u4s (more details), 2 Å

PDB Description: Plasmodium falciparum lactate dehydrogenase complexed with 2,6-naphthalenedisulphonic acid
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1u4sa1:

Sequence, based on SEQRES records: (download)

>d1u4sa1 c.2.1.5 (A:18-164) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
iivvtnpvdvmvqllhqhsgvpknkiiglg

Sequence, based on observed residues (ATOM records): (download)

>d1u4sa1 c.2.1.5 (A:18-164) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
sgsntyddlagadvvivtagftknrddllplnnkimieigghikkncpnafiivvtnpvd
vmvqllhqhsgvpknkiiglg

SCOPe Domain Coordinates for d1u4sa1:

Click to download the PDB-style file with coordinates for d1u4sa1.
(The format of our PDB-style files is described here.)

Timeline for d1u4sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u4sa2