SCOP 1.75: Domain d1u4oa2: 1u4o A:164-328

Lineage for d1u4oa2 (1u4o A:164-328)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)

6. Protein Lactate dehydrogenase [56339] (15 species)

7. Species Plasmodium berghei [TaxId:5821] [103325] (7 PDB entries)

8. Domain d1u4oa2: 1u4o A:164-328 [119528]
   Other proteins in same PDB: d1u4oa1
   automatically matched to d1oc4a2
   complexed with mpd, ndd

Details for d1u4oa2

PDB Entry: 1u4o, 1.7 Å

PDB Description: Plasmodium falciparum lactate dehydrogenase complexed with 2,6-naphthalenedicarboxylic acid

PDB Compounds: (A:) l-lactate dehydrogenase

SCOP Domain Sequences for d1u4oa2:

Sequence; same for both SEQRES and ATOM records:

>d1u4oa2 d.162.1.1 (A:164-328) Lactate dehydrogenase {Plasmodium berghei [TaxId: 5821]}
ggvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnklis
daeleaifdrtvntaleivnlhaspyvapaaaiiemaesylkdlkkvlicstllegqygh
sdifggtpvvlgangveqvielqlnseekakfdeaiaetkrmkal

Timeline for d1u4oa2:

• d1u4oa2 first appeared in SCOP 1.73
  
• d1u4oa2 appears in SCOPe 2.01
  
• d1u4oa2 appears in the current release, SCOPe 2.08