Lineage for d1u4oa1 (1u4o A:18-163)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1348919Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1348958Protein Lactate dehydrogenase [51859] (17 species)
  7. 1349057Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51863] (17 PDB entries)
  8. 1349061Domain d1u4oa1: 1u4o A:18-163 [119527]
    Other proteins in same PDB: d1u4oa2
    automatically matched to d1oc4a1
    complexed with mpd, ndd

Details for d1u4oa1

PDB Entry: 1u4o (more details), 1.7 Å

PDB Description: Plasmodium falciparum lactate dehydrogenase complexed with 2,6-naphthalenedicarboxylic acid
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1u4oa1:

Sequence, based on SEQRES records: (download)

>d1u4oa1 c.2.1.5 (A:18-163) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
iivvtnpvdvmvqllhqhsgvpknkiigl

Sequence, based on observed residues (ATOM records): (download)

>d1u4oa1 c.2.1.5 (A:18-163) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
sgsntyddlagadvvivtagftknrddllplnnkimieigghikkncpnafiivvtnpvd
vmvqllhqhsgvpknkiigl

SCOPe Domain Coordinates for d1u4oa1:

Click to download the PDB-style file with coordinates for d1u4oa1.
(The format of our PDB-style files is described here.)

Timeline for d1u4oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u4oa2