Lineage for d1u4aa1 (1u4a A:14-92)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2177213Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2178109Protein Ubiquitin-like protein smt3a, SUMO-3 [142938] (1 species)
  7. 2178110Species Human (Homo sapiens) [TaxId:9606] [142939] (1 PDB entry)
    Uniprot P55854 14-92
  8. 2178111Domain d1u4aa1: 1u4a A:14-92 [119526]

Details for d1u4aa1

PDB Entry: 1u4a (more details)

PDB Description: solution structure of human sumo-3 c47s
PDB Compounds: (A:) Ubiquitin-like protein SMT3A

SCOPe Domain Sequences for d1u4aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u4aa1 d.15.1.1 (A:14-92) Ubiquitin-like protein smt3a, SUMO-3 {Human (Homo sapiens) [TaxId: 9606]}
ndhinlkvagqdgsvvqfkikrhtplsklmkayserqglsmrqirfrfdgqpinetdtpa
qlemededtidvfqqqtgg

SCOPe Domain Coordinates for d1u4aa1:

Click to download the PDB-style file with coordinates for d1u4aa1.
(The format of our PDB-style files is described here.)

Timeline for d1u4aa1: