Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (17 PDB entries) |
Domain d1u3hg2: 1u3h G:1-81 [119515] Other proteins in same PDB: d1u3ha1, d1u3hb1, d1u3hc1, d1u3hd1, d1u3hd2, d1u3he1, d1u3hf1, d1u3hg1, d1u3hh1, d1u3hh2 automatically matched to d1k2da2 mutant |
PDB Entry: 1u3h (more details), 2.42 Å
SCOP Domain Sequences for d1u3hg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u3hg2 d.19.1.1 (G:1-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]} ieadhvgsygivvyqspgdigqytfefdgdelfyvdldkketiwmlpefaqlrsfdpqgg lqniatgkhnlgvltkrsnstp
Timeline for d1u3hg2: