SCOP 1.75: Domain d1u3hg2: 1u3h G:1-81

Lineage for d1u3hg2 (1u3h G:1-81)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (17 PDB entries)

8. Domain d1u3hg2: 1u3h G:1-81 [119515]
   Other proteins in same PDB: d1u3ha1, d1u3hb1, d1u3hc1, d1u3hd1, d1u3hd2, d1u3he1, d1u3hf1, d1u3hg1, d1u3hh1, d1u3hh2
   automatically matched to d1k2da2
   mutant

Details for d1u3hg2

PDB Entry: 1u3h, 2.42 Å

PDB Description: crystal structure of mouse tcr 172.10 complexed with mhc class ii i-au molecule at 2.4 a

PDB Compounds: (G:) H-2 class II histocompatibility antigen, A-U alpha chain

SCOP Domain Sequences for d1u3hg2:

Sequence; same for both SEQRES and ATOM records:

>d1u3hg2 d.19.1.1 (G:1-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
ieadhvgsygivvyqspgdigqytfefdgdelfyvdldkketiwmlpefaqlrsfdpqgg
lqniatgkhnlgvltkrsnstp

Timeline for d1u3hg2:

• d1u3hg2 first appeared in SCOP 1.73
  
• d1u3hg2 appears in SCOPe 2.01
  
• d1u3hg2 appears in the current release, SCOPe 2.08