Lineage for d1u3hd1 (1u3h D:93-190)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1760407Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 1760478Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (17 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 1760484Domain d1u3hd1: 1u3h D:93-190 [119512]
    Other proteins in same PDB: d1u3ha1, d1u3hb1, d1u3hc1, d1u3hc2, d1u3hd2, d1u3he_, d1u3hf_, d1u3hg1, d1u3hg2, d1u3hh2
    automated match to d1k2db1

Details for d1u3hd1

PDB Entry: 1u3h (more details), 2.42 Å

PDB Description: crystal structure of mouse tcr 172.10 complexed with mhc class ii i-au molecule at 2.4 a
PDB Compounds: (D:) H-2 class II histocompatibility antigen, A-U beta chain

SCOPe Domain Sequences for d1u3hd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3hd1 b.1.1.2 (D:93-190) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
rleqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngd
wtfqvlvmlemtprrgevytchvehpslkspitvewra

SCOPe Domain Coordinates for d1u3hd1:

Click to download the PDB-style file with coordinates for d1u3hd1.
(The format of our PDB-style files is described here.)

Timeline for d1u3hd1: