SCOPe 2.07: Domain d1u3ba1: 1u3b A:19-107

Lineage for d1u3ba1 (1u3b A:19-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) [141282] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141283] (6 PDB entries)
   Uniprot Q02410 656-740! Uniprot Q02410 657-743! Uniprot Q02410 657-745! Uniprot Q02410 743-822! Uniprot Q02410 745-823! Uniprot Q02410 746-839
   structure of the PTB domain is also known (50757)

8. Domain d1u3ba1: 1u3b A:19-107 [119508]
   Other proteins in same PDB: d1u3ba3

Details for d1u3ba1

PDB Entry: 1u3b

PDB Description: auto-inhibition mechanism of x11s/mints family scaffold proteins revealed by the closed conformation of the tandem pdz domains

PDB Compounds: (A:) amyloid beta A4 precursor protein-binding, family A, member 1

SCOPe Domain Sequences for d1u3ba1:

Sequence; same for both SEQRES and ATOM records:

>d1u3ba1 b.36.1.1 (A:19-107) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]}
kdvfiekqkgeilgvvivesgwgsilptviianmmhggpaeksgklnigdqimsingtsl
vglplstcqsiikglknqsrvklnivrcp

Timeline for d1u3ba1:

• d1u3ba1 first appeared in SCOP 1.73
  
• d1u3ba1 appears in SCOPe 2.06
  
• d1u3ba1 appears in the current release, SCOPe 2.08