Lineage for d1u3ba1 (1u3b A:19-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2785893Protein Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) [141282] (1 species)
  7. 2785894Species Human (Homo sapiens) [TaxId:9606] [141283] (6 PDB entries)
    Uniprot Q02410 656-740! Uniprot Q02410 657-743! Uniprot Q02410 657-745! Uniprot Q02410 743-822! Uniprot Q02410 745-823! Uniprot Q02410 746-839
    structure of the PTB domain is also known (50757)
  8. 2785897Domain d1u3ba1: 1u3b A:19-107 [119508]
    Other proteins in same PDB: d1u3ba3

Details for d1u3ba1

PDB Entry: 1u3b (more details)

PDB Description: auto-inhibition mechanism of x11s/mints family scaffold proteins revealed by the closed conformation of the tandem pdz domains
PDB Compounds: (A:) amyloid beta A4 precursor protein-binding, family A, member 1

SCOPe Domain Sequences for d1u3ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3ba1 b.36.1.1 (A:19-107) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]}
kdvfiekqkgeilgvvivesgwgsilptviianmmhggpaeksgklnigdqimsingtsl
vglplstcqsiikglknqsrvklnivrcp

SCOPe Domain Coordinates for d1u3ba1:

Click to download the PDB-style file with coordinates for d1u3ba1.
(The format of our PDB-style files is described here.)

Timeline for d1u3ba1: