![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.13: DsbA-like [100953] (4 proteins) contains an all-alpha subdomain insertion |
![]() | Protein Disulfide-bond formation facilitator (DsbA) [100954] (4 species) the insert subdomain is a 4-helical bundle |
![]() | Species Escherichia coli [TaxId:562] [100955] (17 PDB entries) |
![]() | Domain d1u3aa_: 1u3a A: [119504] automated match to d1a23__ complexed with pe5; mutant |
PDB Entry: 1u3a (more details), 2 Å
SCOPe Domain Sequences for d1u3aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u3aa_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} qyedgkqyttlekpvagapqvleffsffcphayqfeevlhisdnvkkklpegvkmtkyhv nfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgee ydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyadt vkylsek
Timeline for d1u3aa_: