SCOPe 2.06: Domain d1u38a1: 1u38 A:19-105

Lineage for d1u38a1 (1u38 A:19-105)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) [141282] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141283] (6 PDB entries)
   Uniprot Q02410 656-740! Uniprot Q02410 657-743! Uniprot Q02410 657-745! Uniprot Q02410 743-822! Uniprot Q02410 745-823! Uniprot Q02410 746-839
   structure of the PTB domain is also known (50757)

8. Domain d1u38a1: 1u38 A:19-105 [119502]
   Other proteins in same PDB: d1u38a2
   automatically matched to 1U37 A:19-105

Details for d1u38a1

PDB Entry: 1u38

PDB Description: auto-inhibition mechanism of x11s/mints family scaffold proteins revealed by the closed conformation of the tandem pdz domains

PDB Compounds: (A:) amyloid beta A4 precursor protein-binding, family A, member 1

SCOPe Domain Sequences for d1u38a1:

Sequence; same for both SEQRES and ATOM records:

>d1u38a1 b.36.1.1 (A:19-105) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]}
kdvfiekqkgeilgvvivesgwgsilptviianmmhggpaeksgklnigdqimsingtsl
vglplstcqsiikglknqsrvklnivr

Timeline for d1u38a1:

• d1u38a1 first appeared in SCOP 1.73
  
• d1u38a1 appears in SCOPe 2.05
  
• d1u38a1 appears in SCOPe 2.07
  
• d1u38a1 appears in the current release, SCOPe 2.08