![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
![]() | Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
![]() | Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
![]() | Protein Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) [141282] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141283] (6 PDB entries) Uniprot Q02410 656-740! Uniprot Q02410 657-743! Uniprot Q02410 657-745! Uniprot Q02410 743-822! Uniprot Q02410 745-823! Uniprot Q02410 746-839 structure of the PTB domain is also known (50757) |
![]() | Domain d1u37a1: 1u37 A:19-105 [119501] 1st PDZ domain |
PDB Entry: 1u37 (more details)
SCOPe Domain Sequences for d1u37a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u37a1 b.36.1.1 (A:19-105) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} kdvfiekqkgeilgvvivesgwgsilptviianmmhggpaeksgklnigdqimsingtsl vglplstcqsiikglknqsrvklnivr
Timeline for d1u37a1: