Lineage for d1u37a1 (1u37 A:19-105)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666573Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 666574Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 666575Family b.36.1.1: PDZ domain [50157] (46 proteins)
    Pfam PF00595
  6. 666584Protein Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) [141282] (1 species)
  7. 666585Species Human (Homo sapiens) [TaxId:9606] [141283] (6 PDB entries)
    structure of the PTB domain is also known (scop_sp 50757)
  8. 666587Domain d1u37a1: 1u37 A:19-105 [119501]
    1st PDZ domain

Details for d1u37a1

PDB Entry: 1u37 (more details)

PDB Description: Auto-inhibition Mechanism of X11s/Mints Family Scaffold Proteins Revealed by the Closed Conformation of the Tandem PDZ Domains
PDB Compounds: (A:) amyloid beta A4 precursor protein-binding, family A, member 1

SCOP Domain Sequences for d1u37a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u37a1 b.36.1.1 (A:19-105) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]}
kdvfiekqkgeilgvvivesgwgsilptviianmmhggpaeksgklnigdqimsingtsl
vglplstcqsiikglknqsrvklnivr

SCOP Domain Coordinates for d1u37a1:

Click to download the PDB-style file with coordinates for d1u37a1.
(The format of our PDB-style files is described here.)

Timeline for d1u37a1: