SCOPe 2.06: Domain d1u35g_: 1u35 G:

Lineage for d1u35g_ (1u35 G:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193446] (46 PDB entries)

8. Domain d1u35g_: 1u35 G: [119499]
   Other proteins in same PDB: d1u35a1, d1u35c1, d1u35d1, d1u35e1
   automated match to d1u35c1
   protein/DNA complex

Details for d1u35g_

PDB Entry: 1u35, 3 Å

PDB Description: crystal structure of the nucleosome core particle containing the histone domain of macroh2a

PDB Compounds: (G:) H2A histone family

SCOPe Domain Sequences for d1u35g_:

Sequence; same for both SEQRES and ATOM records:

>d1u35g_ a.22.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ktsrsakagvifpvgrmlryikkghpkyrigvgapvymaavleyltaeilelavnaardn
kkgrvtprhillavandeelnqllkgvtiasggvlpnihpellakk

Timeline for d1u35g_:

• d1u35g_ first appeared in SCOP 1.73, called d1u35g1
  
• d1u35g_ appears in SCOPe 2.05
  
• d1u35g_ appears in SCOPe 2.07
  
• d1u35g_ appears in the current release, SCOPe 2.08