| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (2 proteins) binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode automatically mapped to Pfam PF02233 |
| Protein Transhydrogenase domain III (dIII) [52485] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52486] (3 PDB entries) |
| Domain d1u31b_: 1u31 B: [119492] automated match to d1djla_ complexed with gol, ndp, so4 |
PDB Entry: 1u31 (more details), 2.2 Å
SCOPe Domain Sequences for d1u31b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u31b_ c.31.1.4 (B:) Transhydrogenase domain III (dIII) {Human (Homo sapiens) [TaxId: 9606]}
pmeisgthteinldnaidmireansiiitpgyglcaakaqypiadlvkmlteqgkkvrfg
ihpvagrmpgqlnvllaeagvpydivlemdeinhdfpdtdlvlvigandtvnsaaqedpn
siiagmpvlevwkskqvivmkrslgvgyaavdnpifykpntamllgdakktcdalqakvr
es
Timeline for d1u31b_: