SCOPe 2.08: Domain d1u31b_: 1u31 B:

Lineage for d1u31b_ (1u31 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (2 proteins)
   binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode
   automatically mapped to Pfam PF02233

6. Protein Transhydrogenase domain III (dIII) [52485] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52486] (3 PDB entries)

8. Domain d1u31b_: 1u31 B: [119492]
   automated match to d1djla_
   complexed with gol, ndp, so4

Details for d1u31b_

PDB Entry: 1u31, 2.2 Å

PDB Description: recombinant human heart transhydrogenase dIII bound with NADPH

PDB Compounds: (B:) NAD(P) transhydrogenase, mitochondrial

SCOPe Domain Sequences for d1u31b_:

Sequence; same for both SEQRES and ATOM records:

>d1u31b_ c.31.1.4 (B:) Transhydrogenase domain III (dIII) {Human (Homo sapiens) [TaxId: 9606]}
pmeisgthteinldnaidmireansiiitpgyglcaakaqypiadlvkmlteqgkkvrfg
ihpvagrmpgqlnvllaeagvpydivlemdeinhdfpdtdlvlvigandtvnsaaqedpn
siiagmpvlevwkskqvivmkrslgvgyaavdnpifykpntamllgdakktcdalqakvr
es

Timeline for d1u31b_:

• d1u31b_ first appeared in SCOP 1.73, called d1u31b1
  
• d1u31b_ appears in SCOPe 2.07